PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0094900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 266aa    MW: 29234.4 Da    PI: 10.0539
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0094900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-163378147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede l ++v ++G+ +W+ Ia++++ gR++k+c++rw++ 
   Spipo4G0094900 33 RGHWRPSEDETLRRLVGEYGPQNWNFIAEKLP-GRSGKSCRLRWFNQ 78
                     899*****************************.***********996 PP

2Myb_DNA-binding551.8e-1785127145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r + T+eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+
   Spipo4G0094900  85 RSPLTEEEEERLLAAHRVYGNR-WALIARLFP-GRTDNALKNHWH 127
                      6678******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.9272879IPR017930Myb domain
SMARTSM007173.0E-143281IPR001005SANT/Myb domain
PfamPF002495.4E-163378IPR001005SANT/Myb domain
SuperFamilySSF466892.43E-2833126IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-263486IPR009057Homeodomain-like
CDDcd001672.02E-133677No hitNo description
PROSITE profilePS5129425.90780134IPR017930Myb domain
SMARTSM007177.6E-1584132IPR001005SANT/Myb domain
PfamPF002499.4E-1486127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-1987129IPR009057Homeodomain-like
CDDcd001678.25E-896127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MEGTGGSPVD AGGERGGRTA AAAGSDDQEV GSRGHWRPSE DETLRRLVGE YGPQNWNFIA  60
EKLPGRSGKS CRLRWFNQLD PRIKRSPLTE EEEERLLAAH RVYGNRWALI ARLFPGRTDN  120
ALKNHWHVIN ARRRRAQTRA VGGGREAGRS FAFNNQSSKS LGSSSSSSSQ SGDLSCTAAP  180
KEERSHRNWM TGYGVLESSH CHGQPLSRSF CGSPFYGVYR SGLSLPGKKI AEAFVGENKE  240
KERPDELLNR EKVPFIDFLG VGFAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-32331337107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008810902.12e-67PREDICTED: myb-like protein Q
TrEMBLM0TYK75e-65M0TYK7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P08480_0011e-64(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73410.12e-56myb domain protein 54